Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [3]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA018215 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA018215, RRID:AB_1850443
- Product name
- Anti-GUCA2A
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
SLESVKKLKDLQEPQEPRVGKLRNFAPIPGEPVVP
ILCSNPNFPEELKPLCKEPNAQEILQRLEEIAEDP
GTCEICAYAACTGC- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references The guanylate cyclase-C signaling pathway is down-regulated in inflammatory bowel disease
The paracrine hormone for the GUCY2C tumor suppressor, guanylin, is universally lost in colorectal cancer.
Brenna Ø, Bruland T, Furnes M, Granlund A, Drozdov I, Emgård J, Brønstad G, Kidd M, Sandvik A, Gustafsson B
Scandinavian Journal of Gastroenterology 2015 April;50(10):1241-1252
Scandinavian Journal of Gastroenterology 2015 April;50(10):1241-1252
The paracrine hormone for the GUCY2C tumor suppressor, guanylin, is universally lost in colorectal cancer.
Wilson C, Lin JE, Li P, Snook AE, Gong J, Sato T, Liu C, Girondo MA, Rui H, Hyslop T, Waldman SA
Cancer epidemiology, biomarkers & prevention : a publication of the American Association for Cancer Research, cosponsored by the American Society of Preventive Oncology 2014 Nov;23(11):2328-37
Cancer epidemiology, biomarkers & prevention : a publication of the American Association for Cancer Research, cosponsored by the American Society of Preventive Oncology 2014 Nov;23(11):2328-37
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Recombinant expression validation
- Main image
- Experimental details
- Western blot analysis in control (vector only transfected HEK293T lysate) and gUCA2A over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY409429).
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human small intestine and liver tissues using Anti-GUCA2A antibody. Corresponding GUCA2A RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human small intestine shows high expression.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver shows low expression as expected.
- Sample type
- HUMAN