Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00008907-A01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00008907-A01, RRID:AB_605930
- Product name
- AP1M1 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant AP1M1.
- Antigen sequence
MSASAVYVLDLKGKVLICRNYRGDVDMSEVEHFMP
ILMEKEEEGMLSPILAHGGVRFMWIKHNNLYLVAT
SKKN- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references A novel GTP-binding protein-adaptor protein complex responsible for export of Vangl2 from the trans Golgi network.
Human kidney anion exchanger 1 interacts with adaptor-related protein complex 1 μ1A (AP-1 mu1A).
Guo Y, Zanetti G, Schekman R
eLife 2013 Jan 8;2:e00160
eLife 2013 Jan 8;2:e00160
Human kidney anion exchanger 1 interacts with adaptor-related protein complex 1 μ1A (AP-1 mu1A).
Sawasdee N, Junking M, Ngaojanlar P, Sukomon N, Ungsupravate D, Limjindaporn T, Akkarapatumwong V, Noisakran S, Yenchitsomanus PT
Biochemical and biophysical research communications 2010 Oct 8;401(1):85-91
Biochemical and biophysical research communications 2010 Oct 8;401(1):85-91
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- AP1M1 polyclonal antibody (A01), Lot # 060717JCS1 Western Blot analysis of AP1M1 expression in U-2 OS ( Cat # L022V1 ).