HPA014372

OPALIN antibody from Sigma-Aldrich
HTMP10, TMEM10, TMP10
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014372
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014372, RRID:AB_2158172
Product name
Anti-OPALIN antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014372
Antibody type
Polyclonal
Antigen
Opalin (Oligodendrocytic myelin paranodal and inner loop protein) (Transmembrane protein 10)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RRRSSIEAMEESDRPCEISEIDDNPKISENPRRSP
THEKNTMGAQEAHIYVKTVAGSEEPVHDRYRPTIE
MERRRGLWWLVPRLSLE
Storage
-20C
Provider Type Product Number
- No reagents -