HPA014372

OPALIN antibody from Atlas Antibodies
HTMP10, TMEM10, TMP10
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA014372
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA014372, RRID:AB_2158172
Product name
Anti-OPALIN
Provider product page
Atlas Antibodies - HPA014372
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RRRSSIEAMEESDRPCEISEIDDNPKISENPRRSP
THEKNTMGAQEAHIYVKTVAGSEEPVHDRYRPTIE
MERRRGLWWLVPRLSLE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -