Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010365-M09 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010365-M09, RRID:AB_1679179
- Product name
- KLF2 monoclonal antibody (M09), clone 1D12
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant KLF2.
- Antigen sequence
SWPRKRTATHTCSYAGCGKTYTKSSHLKAHLRTHT
GEKPYHCNWDGCGWKFARSDELTRHYRKHTGHRPF
QCHLCDRAFSRSDHLALH- Isotype
- IgG
- Antibody clone number
- 1D12
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Kruppel-like factor 2 modulates CCR5 expression and susceptibility to HIV-1 infection.
Richardson MW, Jadlowsky J, Didigu CA, Doms RW, Riley JL
Journal of immunology (Baltimore, Md. : 1950) 2012 Oct 15;189(8):3815-21
Journal of immunology (Baltimore, Md. : 1950) 2012 Oct 15;189(8):3815-21
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- KLF2 monoclonal antibody (M09), clone 1D12. Western Blot analysis of KLF2 expression in IMR-32.