Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183306 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Zinc Finger Protein 785 (ZNF785) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ZNF785 antibody: synthetic peptide directed towards the C terminal of human ZNF785
- Description
- Affinity Purified
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
RKTALEAHRWIHRSCSERRAWQQAVVGRSEPIPVL
GGKDP PVHFRHFPDI- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Genome duplications and other features in 12 Mb of DNA sequence from human chromosome 16p and 16q.
Loftus BJ, Kim UJ, Sneddon VP, Kalush F, Brandon R, Fuhrmann J, Mason T, Crosby ML, Barnstead M, Cronin L, Deslattes Mays A, Cao Y, Xu RX, Kang HL, Mitchell S, Eichler EE, Harris PC, Venter JC, Adams MD
Genomics 1999 Sep 15;60(3):295-308
Genomics 1999 Sep 15;60(3):295-308
No comments: Submit comment
No validations: Submit validation data