H00080380-M06
antibody from Abnova Corporation
Targeting: PDCD1LG2
B7-DC, bA574F11.2, Btdc, CD273, PD-L2, PDL2
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00080380-M06 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00080380-M06, RRID:AB_11122765
- Product name
- PDCD1LG2 monoclonal antibody (M06), clone 7D5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant PDCD1LG2.
- Antigen sequence
TVTVPKELYIIEHGSNVTLECNFDTGSHVNLGAIT
ASLQKVENDTSPHRERATLLEEQLPLGKASFHIPQ
VQVRDEGQYQCIIIYGVAWD- Isotype
- IgG
- Antibody clone number
- 7D5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of PDCD1LG2 expression in transfected 293T cell line by PDCD1LG2 monoclonal antibody (M06), clone 7D5.Lane 1: PDCD1LG2 transfected lysate (Predicted MW: 30.03 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged PDCD1LG2 is 0.3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol