HPA013411

PDCD1LG2 antibody from Sigma-Aldrich
B7-DC, bA574F11.2, Btdc, CD273, PD-L2, PDL2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013411
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA013411, RRID:AB_1855102
Product name
Anti-PDCD1LG2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA013411
Antibody type
Polyclonal
Antigen
Programmed cell death 1 ligand 2 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GYPLAEVSWPNVSVPANTSHSRTPEGLYQVTSVLR
LKPPPGRNFSCVFWNTHVRELTLASIDLQSQMEPR
THPT
Storage
-20C
Provider Type Product Number
- No reagents -