HPA013411

PDCD1LG2 antibody from Atlas Antibodies
B7-DC, bA574F11.2, Btdc, CD273, PD-L2, PDL2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA013411
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA013411, RRID:AB_1855102
Product name
Anti-PDCD1LG2
Provider product page
Atlas Antibodies - HPA013411
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GYPLAEVSWPNVSVPANTSHSRTPEGLYQVTSVLR
LKPPPGRNFSCVFWNTHVRELTLASIDLQSQMEPR
THPT
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -