HPA015625

TIMD4 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015625
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015625, RRID:AB_1858018
Product name
Anti-TIMD4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015625
Antibody type
Polyclonal
Antigen
T-cell immunoglobulin and mucin domain-containing protein 4 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VFTTANTCLSLTPSTLPEEATGLLTPEPSKEGPIL
TAESETVLPSDSWSSVESTSADTVLLTSKESKVWD
LPSTSHVSMWKTSDSVSSPQPGASDTAVPEQNKTT
KTGQMDGIPMSMKNEMP
Storage
-20C
Provider Type Product Number
- No reagents -