HPA014374

CDKAL1 antibody from Sigma-Aldrich
FLJ20342
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014374
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014374, RRID:AB_1846443
Product name
Anti-CDKAL1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014374
Antibody type
Polyclonal
Antigen
CDK5 regulatory subunit-associated protein 1-like 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CDTLLDDIEDIVSQEDSKPQDRHFVRKDVVPKVRR
RNTQKYLQEEENSPPSDSTIPGIQKIWIRTWGCSH
NNSDGEYMAGQLAAYGYKITENASDADLWLLNSCT
VKNPAEDHFRNSIKKAQEENKKIVLAGCLPQAQP
Storage
-20C
Provider Type Product Number
- No reagents -