Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00057449-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00057449-M01, RRID:AB_566088
- Product name
- PLEKHG5 monoclonal antibody (M01), clone 5A9
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant PLEKHG5.
- Antigen sequence
SAPSRSLSELCLAVPAPGIRTQGSPQEAGPSWDCR
GAPSPGSGPGLVGCLAGEPAGSHRKRCGDLPSGAS
PRVQPEPPPGVSAQHRKLTLAQLYRIRTTL- Isotype
- IgG
- Antibody clone number
- 5A9
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Phosphorylation-mediated 14-3-3 protein binding regulates the function of the rho-specific guanine nucleotide exchange factor (RhoGEF) Syx.
VEGF and Angiopoietin-1 exert opposing effects on cell junctions by regulating the Rho GEF Syx.
Ngok SP, Geyer R, Kourtidis A, Storz P, Anastasiadis PZ
The Journal of biological chemistry 2013 Mar 1;288(9):6640-50
The Journal of biological chemistry 2013 Mar 1;288(9):6640-50
VEGF and Angiopoietin-1 exert opposing effects on cell junctions by regulating the Rho GEF Syx.
Ngok SP, Geyer R, Liu M, Kourtidis A, Agrawal S, Wu C, Seerapu HR, Lewis-Tuffin LJ, Moodie KL, Huveldt D, Marx R, Baraban JM, Storz P, Horowitz A, Anastasiadis PZ
The Journal of cell biology 2012 Dec 24;199(7):1103-15
The Journal of cell biology 2012 Dec 24;199(7):1103-15
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged PLEKHG5 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to PLEKHG5 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to PLEKHG5 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 1.5 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol