HPA025060

PHF20L1 antibody from Sigma-Aldrich
CGI-72, FLJ13649, FLJ21615, MGC64923, TDRD20B
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA025060
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA025060, RRID:AB_10599822
Product name
Anti-PHF20L1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA025060
Antibody type
Polyclonal
Antigen
PHD finger protein 20-like 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LLADVYGVTEVLHGLQLKIGILKNKHHPDLHLWAC
SGKRKDQDQIIAGVEKKIAQDTVNREEKKYVQNHK
EPPRLP
Storage
-20C
Provider Type Product Number
- No reagents -