Explore
Validate
LearnPAB22821
antibody from Abnova Corporation
Targeting: KIF4A
FLJ12530, FLJ12655, FLJ14204, FLJ20631, HSA271784, KIF4, KIF4-G1, MRX100
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB22821 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#PAB22821, RRID:AB_10963761
- Product name
- KIF4A polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant KIF4A.
- Antigen sequence
LTLLQVASRQKHLPKDTLLSPDSSFEYVPPKPKPS
RVKEKFLEQSMDIEDLKYCSEHSVNEHEDGDGDDD
EGDDEEWKPTKL- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with KIF4A polyclonal antibody (Cat # PAB22821) at 1:250-1:500 dilution.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-2 OS with KIF4A polyclonal antibody (Cat # PAB22821) at 1-4 ug/mL dilution shows positivity in nucleus.
- Validation comment
- Immunofluorescence
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human bone marrow with KIF4A polyclonal antibody (Cat # PAB22821) shows strong nuclear positivity in hematopoietic cells at 1:200-1:500 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
