HPA000781

ELFN2 antibody from Atlas Antibodies
dJ63G5.3, KIAA1904, LRRC62, PPP1R29
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA000781
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA000781, RRID:AB_611973
Product name
Anti-ELFN2
Provider product page
Atlas Antibodies - HPA000781
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GIHHLEVKPAYHCSEHRHSFPALYYEEGADSLSQR
VSFLKPLTRSKRDSTYSQLSPRHYYSGYSSSPEYS
SESTHKIWERFRPYKKHHREEVYMAAGHALRKKVQ
FAKDEDLHDILDYWK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -