HPA000781

ELFN2 antibody from Sigma-Aldrich
dJ63G5.3, KIAA1904, LRRC62, PPP1R29
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000781
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000781, RRID:AB_1079280
Product name
Anti-LRRC62 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000781
Antibody type
Polyclonal
Antigen
Leucine-rich repeat and fibronectin type-III domain-containing protein 6 precursor (Extracellular leucine-rich repeat and fibronectin type III domain-containing protein 2) recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GIHHLEVKPAYHCSEHRHSFPALYYEEGADSLSQR
VSFLKPLTRSKRDSTYSQLSPRHYYSGYSSSPEYS
SESTHKIWERFRPYKKHHREEVYMAAGHALRKKVQ
FAKDEDLHDILDYWK
Storage
-20C
Provider Type Product Number
- No reagents -