Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010523-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010523-M01, RRID:AB_490043
- Product name
- CHERP monoclonal antibody (M01), clone 2H5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CHERP.
- Antigen sequence
GSNSAPPIPDSRLGEENKGHQMLVKMGWSGSGGLG
AKEQGIQDPIKGGDVRDKWDQYKGVGVALDDPYEN
YRRNKSYSFIARMKARDEC- Isotype
- IgG
- Antibody clone number
- 2H5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Nuclear ALG-2 protein interacts with Ca2+ homeostasis endoplasmic reticulum protein (CHERP) Ca2+-dependently and participates in regulation of alternative splicing of inositol trisphosphate receptor type 1 (IP3R1) pre-mRNA.
Sasaki-Osugi K, Imoto C, Takahara T, Shibata H, Maki M
The Journal of biological chemistry 2013 Nov 15;288(46):33361-75
The Journal of biological chemistry 2013 Nov 15;288(46):33361-75
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- CHERP monoclonal antibody (M01), clone 2H5 Western Blot analysis of CHERP expression in IMR-32 ( Cat # L008V1 ).