H00011142-M10

PKIG antibody from Abnova Corporation
No application information provided.

Antibody data

Product number
H00011142-M10
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00011142-M10, RRID:AB_1137374
Product name
PKIG monoclonal antibody (M10), clone 2D9
Provider product page
Abnova Corporation - H00011142-M10
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant PKIG.
Antigen sequence
MMEVESSYSDFISCDRTGRRNAVPDIQGDSEAVSV
RKLAGDMGELALEGAEGQVEGSAPDKEAGNQPQSS
DGTTSS
Isotype
IgG
Antibody clone number
2D9
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -