HPA012133

SMIM7 antibody from Sigma-Aldrich
C19orf42, MGC2747
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012133
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012133, RRID:AB_1845618
Product name
Anti-AC024075.4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012133
Antibody type
Polyclonal
Antigen
Putative uncharacterized protein ENSP00000351569 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MPSLHSSIPDDFKNVFDQKTDNLPRKSKLVVGGKV
FAEVCMVSQPRPC
Storage
-20C
Provider Type Product Number
- No reagents -