HPA013738

NHLRC3 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013738
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA013738, RRID:AB_1854455
Product name
Anti-NHLRC3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA013738
Antibody type
Polyclonal
Antigen
NHL repeat-containing protein 3 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ILWLHGENGTGPAKFNIPHSVTLDSAGRVWVADRG
NKRIQVFDKDTGEWLGAWNNCFTEEGPSSVRFTPD
GKYLIVAQLNLSRLSVVAAPPVGSIGECSVISTIQ
LADQ
Storage
-20C
Provider Type Product Number
- No reagents -