HPA018199

KLRG2 antibody from Sigma-Aldrich
CLEC15B, FLJ44186
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018199
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018199, RRID:AB_2133260
Product name
Anti-KLRG2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018199
Antibody type
Polyclonal
Antigen
Killer cell lectin-like receptor subfamily G member 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EEHCYYFSAEAQAWEASQAFCSAYHATLPLLSHTQ
DFLGRYPVSRHSWVGAWRGPQGWHWIDEAPLPPQL
LPEDGEDNLDINCGALEEGTLVAANCSTPRPWVCA
KGT
Storage
-20C
Provider Type Product Number
- No reagents -