Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00055937-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00055937-M02, RRID:AB_509072
- Product name
- APOM monoclonal antibody (M02), clone 2E5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant APOM.
- Antigen sequence
CPEHSQLTTLGVDGKEFPEVHLGQWYFIAGAAPTK
EELATFDPVDNIVFNMAAGSAPMQLHLRATIRMKD
GLCVPRKWIYHLTEGSTDLRTEGRPDMKTELFSSS
CPGGIMLNETGQGYQRFLLYNRSPHPPEKCVEEFK
SLTSCLDSKAFLLTPRNQEACELSNN- Isotype
- IgG
- Antibody clone number
- 2E5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Apolipoprotein M gene (APOM) polymorphism modifies metabolic and disease traits in type 2 diabetes.
Evaluation of apolipoprotein M as a biomarker of coronary artery disease.
Zhou JW, Tsui SK, Ng MC, Geng H, Li SK, So WY, Ma RC, Wang Y, Tao Q, Chen ZY, Chan JC, Ho YY
PloS one 2011 Feb 24;6(2):e17324
PloS one 2011 Feb 24;6(2):e17324
Evaluation of apolipoprotein M as a biomarker of coronary artery disease.
Su W, Jiao G, Yang C, Ye Y
Clinical biochemistry 2009 Mar;42(4-5):365-70
Clinical biochemistry 2009 Mar;42(4-5):365-70
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged APOM is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol