Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00055937-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00055937-M01, RRID:AB_426027
- Product name
- APOM monoclonal antibody (M01), clone 1F10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant APOM.
- Antigen sequence
CPEHSQLTTLGVDGKEFPEVHLGQWYFIAGAAPTK
EELATFDPVDNIVFNMAAGSAPMQLHLRATIRMKD
GLCVPRKWIYHLTEGSTDLRTEGRPDMKTELFSSS
CPGGIMLNETGQGYQRFLLYNRSPHPPEKCVEEFK
SLTSCLDSKAFLLTPRNQEACELSNN- Isotype
- IgG
- Antibody clone number
- 1F10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Effects of simvastatin on apolipoprotein M in vivo and in vitro.
Liver X receptor agonist downregulates hepatic apoM expression in vivo and in vitro.
Zhang X, Mao S, Luo G, Wei J, Berggren-Söderlund M, Nilsson-Ehle P, Xu N
Lipids in health and disease 2011 Jul 5;10:112
Lipids in health and disease 2011 Jul 5;10:112
Liver X receptor agonist downregulates hepatic apoM expression in vivo and in vitro.
Zhang X, Zhu Z, Luo G, Zheng L, Nilsson-Ehle P, Xu N
Biochemical and biophysical research communications 2008 Jun 20;371(1):114-7
Biochemical and biophysical research communications 2008 Jun 20;371(1):114-7
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of APOM expression in transfected 293T cell line by APOM monoclonal antibody (M01), clone 1F10.Lane 1: APOM transfected lysate(21.3 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged APOM is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol