HPA015620

ASTL antibody from Sigma-Aldrich
ovastacin, SAS1B
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015620
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015620, RRID:AB_1845121
Product name
Anti-ASTL antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015620
Antibody type
Polyclonal
Antigen
Astacin-like metalloendopeptidase precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SGDKDIPAINQGLILEETPESSFLIEGDIIRPSPF
RLLSATSNKWPMGGSGVVEVPFLLSSKYDEPSRQV
ILEALAEFERSTCIRFVTYQDQRDFISIIPMYGCF
SSVGRSGGMQVVSLAPTCLQK
Storage
-20C
Provider Type Product Number
- No reagents -