Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00023309-B01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00023309-B01, RRID:AB_1115488
- Product name
- SIN3B MaxPab mouse polyclonal antibody (B01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a full-length human SIN3B protein.
- Antigen sequence
MAHAGGGSGGSGAGGPAGRGLSGARWGRSGSAGHE
KLPVHVEDALTYLDQVKIRFGSDPATYNGFLEIMK
EFKSQSIDTPGVIRRVSQLFHEHPDLIVGFNAFLP
LGYRIDIPKNGKLNIQSPLTSQENSHNHGDGAEDF
KQQVPYKEDKPQVPLESDSVEFNNAISYVNKIKTR
FLDHPEIYRSFLEILHTYQKEQLNTRGRPFRGMSE
EEVFTEVANLFRGQEDLLSEFGQFLPEAKRSLFTG
NGPCEMHSVQKNEHDKTPEHSRKRSRPSLLRPVSA
PAKKKMKLRGTKDLSIAAVGKYGTLQEFSFFDKVR
RVLKSQEVYENFLRCIALFNQELVSGSELLQLVSP
FLG- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of SIN3B expression in transfected 293T cell line (H00023309-T01) by SIN3B MaxPab polyclonal antibody.Lane 1: SIN3B transfected lysate(38.83 KDa).Lane 2: Non-transfected lysate.