HPA015538

LRIG2 antibody from Sigma-Aldrich
KIAA0806
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015538
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015538, RRID:AB_2250170
Product name
Anti-LRIG2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015538
Antibody type
Polyclonal
Antigen
Leucine-rich repeats and immunoglobulin-like domains protein 2 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IPSYLSSQGTLSEPQEGYSNSEAGSHQQLMPPANG
YIHKGTDGGTGTRVICSDCYDNANIYSRTREYCPY
TYIAEEDVLDQTLSSLMVQMPKETYLVHPPQDTTA
LESLIPSANREPSAFPTNHERISEKKLPSTQMSGE
TLQRPVWNINRELGLPHPPFSQQPVHESPQLHQNE
GLAGREPDCSASSMSCHRLQDHAF
Storage
-20C
Provider Type Product Number
- No reagents -