HPA040466

ST3GAL1 antibody from Atlas Antibodies
SIAT4A, SIATFL, ST3GalA.1, ST3O
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA040466
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA040466, RRID:AB_10805712
Product name
Anti-ST3GAL1
Provider product page
Atlas Antibodies - HPA040466
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MVLELSENLKRLIKHRPCTCTHCIGQRKLSAWFDE
RFNQTMQPLLTAQNALLEDDTYRWWLRLQREKKPN
NLNDTIKELFRVVPGNVDPMLEKRSVGCRRCAVVG
NSGNLRESSYGPEIDSHDFVLRMNKAPTAGFEA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -