AV45410

ST3GAL1 antibody from MilliporeSigma / Merck KGaA
SIAT4A, SIATFL, ST3GalA.1, ST3O
No application information provided.

Antibody data

Product number
AV45410
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#AV45410, RRID:AB_1857521
Product name
Anti-ST3GAL1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - AV45410
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human ST3GAL1 with an internal ID of P26377
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IKYVFDNWLQGHGRYPSTGILSVIFSMHVCDEVDL
YGFGADSKGNWHHYW
Storage
-20C
Provider Type Product Number
- No reagents -