HPA063592

ZFAT antibody from Atlas Antibodies
KIAA1485, ZFAT1, ZNF406

Antibody data

Product number
HPA063592
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA063592, RRID:AB_2685051
Product name
Anti-ZFAT
Provider product page
Atlas Antibodies - HPA063592
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SESGDRLDPTAVNILQQIIELGAETHDATALASVV
AMAPGTVTVVKQVTEEEPSSNHTVMIQETVQQASV
ELAEQHHLVVSSDDVEGIETVTVYTQGGEASEFIV
YVQE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.