HPA000649

NAGA antibody from Sigma-Aldrich
D22S674
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000649
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000649, RRID:AB_1079448
Product name
Anti-NAGA antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000649
Antibody type
Polyclonal
Antigen
alpha-N-Acetylgalactosaminidase precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
WLAWERFRCNINCDEDPKNCISEQLFMEMADRMAQ
DGWRDMGYTYLNIDDCWIGGRDASGRLMPDPKRFP
HGIPFLADYVHSLGLKLGIYADMGNFTCMGYPGTT
LDKVVQDAQTFAEWKVDMLKLDGCFST
Storage
-20C
Provider Type Product Number
- No reagents -