HPA014862

SLC22A9 antibody from Sigma-Aldrich
FLJ23666, OAT4, OAT7, UST3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014862
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014862, RRID:AB_1854757
Product name
Anti-SLC22A9 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014862
Antibody type
Polyclonal
Antigen
Solute carrier family 22 member 9 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RVGNTQIPGHGNYIGNVPFWYCIYDPGRPGFCHSR
LAYPPAGGVCTILCDLSDLK
Storage
-20C
Provider Type Product Number
- No reagents -