H00153769-M01
antibody from Abnova Corporation
Targeting: SH3RF2
FLJ23654, Hepp1, POSHER, PPP1R39, RNF158
Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00153769-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00153769-M01, RRID:AB_607021
- Product name
- SH3RF2 monoclonal antibody (M01), clone 4E10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SH3RF2.
- Antigen sequence
VKTVRFQNYSPPPTKHYTSHPTSGKPEQPATLKAS
QPEAASLGPEMTVLFAHRSGCHSGQQTDLRRKSAL
AKATTLVSTASGTQTVFPSK- Isotype
- IgG
- Antibody clone number
- 4E10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references SH3RF2 functions as an oncogene by mediating PAK4 protein stability.
Sh3rf2/POSHER protein promotes cell survival by ring-mediated proteasomal degradation of the c-Jun N-terminal kinase scaffold POSH (Plenty of SH3s) protein.
Kim TW, Kang YK, Park ZY, Kim YH, Hong SW, Oh SJ, Sohn HA, Yang SJ, Jang YJ, Lee DC, Kim SY, Yoo HS, Kim E, Yeom YI, Park KC
Carcinogenesis 2014 Mar;35(3):624-34
Carcinogenesis 2014 Mar;35(3):624-34
Sh3rf2/POSHER protein promotes cell survival by ring-mediated proteasomal degradation of the c-Jun N-terminal kinase scaffold POSH (Plenty of SH3s) protein.
Wilhelm M, Kukekov NV, Schmit TL, Biagas KV, Sproul AA, Gire S, Maes ME, Xu Z, Greene LA
The Journal of biological chemistry 2012 Jan 13;287(3):2247-56
The Journal of biological chemistry 2012 Jan 13;287(3):2247-56
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged SH3RF2 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol