HPA058606

ABHD16A antibody from Atlas Antibodies
BAT5, D6S82E, NG26
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA058606
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA058606, RRID:AB_2683774
Product name
Anti-ABHD16A
Provider product page
Atlas Antibodies - HPA058606
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GLVTRTVRQHLNLNNAEQLCRYQGPVLLIRRTKDE
IITTTVPEDIM
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -