HPA019018

MCTP1 antibody from MilliporeSigma / Merck KGaA
FLJ22344
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019018
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA019018, RRID:AB_1853665
Product name
Anti-MCTP1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA019018
Antibody type
Polyclonal
Antigen
Multiple C2 and transmembrane domain-containing protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VFDYDFGLQDDFMGSAFLDLTQLELNRPTDVTLTL
KDPHYPDHDLGIILLSVILTPKEGESRDVTMLMRK
SWKRSSKFQTQSLRLSDLHRKSHLWRGIVSITLIE
GRDLKAMDSNGLSDPYVKFRLGH
Storage
-20C
Provider Type Product Number
- No reagents -