Antibody data

Product number
ABIN404980
Provider
antibodies-online
Product name
anti-Potassium Voltage-Gated Channel, Delayed-Rectifier, Subfamily S, Member 1 (KCNS1) (N-Term) antibody
Provider product page
antibodies-online - ABIN404980
Antibody type
Polyclonal
Antigen
The immunogen for anti-KCNS1 antibody: synthetic peptide directed towards the N terminal of human KCNS1
Description
Affinity Purified
Reactivity
Human
Host
Rabbit
Antigen sequence
LMLLVRGTHYENLRSKVVLPTPLGGRSTETFVSEF
PGPDT GIRWRRSDEA
Epitope
N-Term
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -