H00000758-B02P

MPPED1 antibody from Abnova Corporation
239AB, C22orf1, FAM1A

Antibody data

Product number
H00000758-B02P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00000758-B02P, RRID:AB_1577410
Product name
MPPED1 purified MaxPab mouse polyclonal antibody (B02P)
Provider product page
Abnova Corporation - H00000758-B02P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human MPPED1 protein.
Antigen sequence
MWRSRWDASVLKAEALALLPCGLGMAFSQSHVMAA
RRHQHSRLIIEVDEYSSNPTQAFTFYNINQGRFQP
PHVQMVDPVPHDAPKPPGYTRFVCVSDTHSRTDPI
QMPYGDVLIHAGDFTELGLPSEVKKFNEWLGSLPY
EYKIVIAGNHELTFDQEFMADLIKQDFYYFPSVSK
LKPENYENVQSLLTNCIYLQDSEVTVRGFRIYGSP
WQPWFYGWGFNLPRGQALLEKWNLIPEGVDILITH
GPPLGFLDWVPKKMQRVGCVELLNTVQRRVQPRLH
VFGHIHEGYGVMADGTTTYVNASVCTVNYQPVNPP
IVIDLPTPRNS
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -