HPA014908

CDH8 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014908
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014908, RRID:AB_1845908
Product name
Anti-CDH8 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014908
Antibody type
Polyclonal
Antigen
Cadherin-8 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TLTVTLTDVNDNPPKFAQSLYHFSVPEDVVLGTAI
GRVKANDQDIGENAQSSYDIIDGDGTALFEITSDA
QAQDGIIRLRKPLDFETKKSYTLKVEAANVHIDPR
FSGRGPFKDTAT
Storage
-20C
Provider Type Product Number
- No reagents -