HPA026787

HUS1 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026787
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026787, RRID:AB_10601431
Product name
Anti-HUS1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026787
Antibody type
Polyclonal
Antigen
HUS1 checkpoint homolog (S. pombe) recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NHFTRISNMIAKLAKTCTLRISPDKLNFILCDKLA
NGGVSMWCELEQENFFNEFQMEGVSAENNEIYLEL
TSENLSRASKTAQNARALKIKLTNKHFPCLTVSVE
LLSMSSSSRIVTHD
Storage
-20C
Provider Type Product Number
- No reagents -