HPA015762

ADGRL3 antibody from MilliporeSigma / Merck KGaA
KIAA0768, LEC3, LPHN3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015762
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA015762, RRID:AB_1853245
Product name
Anti-LPHN3 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA015762
Antibody type
Polyclonal
Antigen
Latrophilin-3 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LCLAPDGIWDPQGPDLSNCSSPWVNHITQKLKSGE
TAANIARELAEQTRNHLNAGDITYSVRAMDQLVGL
LDVQLRNLTPGGKDSAARSLN
Storage
-20C
Provider Type Product Number
- No reagents -