H00080318-M01

GKAP1 antibody from Abnova Corporation
FKSG21, GKAP42

Antibody data

Product number
H00080318-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00080318-M01, RRID:AB_1237716
Product name
GKAP1 monoclonal antibody (M01), clone 1B9
Provider product page
Abnova Corporation - H00080318-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant GKAP1.
Antigen sequence
MASAVLSSVPTTASRFALLQVDSGSGSDSEPGKGK
GRNTGKSQTLGSKSTTNEKKREKRRKKKEQQQSEA
NELRNLAFKKIPQKSSHAVCNAQHDLPLSNPVQKD
SREENWQEWRQRDEQLTSEMFEADLEKALLLSKLE
YEEHKKEYEDAENTSTQSKVMNKKDKRKNHQGKDR
PLTVSLKDFHSEDHISKKTEELSSSQTLSHDGGFF
NRLEDDVHKILIREKRREQLTEYNGTDNCTAHEHN
QEVVLKDGRIERLKLELERKDAEIQKLKNVITQWE
AKYKEVKARNAQLLKMLQEGEMKDKAEILLQVDES
QSIKNELTIQVTSLHAALEQERSKVKVLQAELAKY
QGGRKGKRNSESDQCR
Isotype
IgG
Antibody clone number
1B9
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -