HPA024071

SIGMAR1 antibody from Sigma-Aldrich
OPRS1, SR-BP1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024071
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024071, RRID:AB_1854803
Product name
Anti-SIGMAR1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024071
Antibody type
Polyclonal
Antigen
Sigma 1-type opioid receptor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGE
TVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFA
LADTVFSTQDFLTLFYTLRSYARGLRLELTTY
Storage
-20C
Provider Type Product Number
- No reagents -