Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN311123 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Patatin-Like phospholipase Domain Containing 5 (PNPLA5) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-PNPLA5 antibody: synthetic peptide directed towards the C terminal of human PNPLA5
- Description
- Affinity Purified
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
NMALEVFSRTKAQLLGPISPPATRVLETSPLQPQI
APHRE ELGPTHQA- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Evaluation of the inhibitory activities of aceraceous plants on fatty acid synthase.
A comparative study of human GS2, its paralogues, and its rat orthologue.
Zhao WH, Gao C, Zhang YX, Tian WX
Journal of enzyme inhibition and medicinal chemistry 2007 Aug;22(4):501-10
Journal of enzyme inhibition and medicinal chemistry 2007 Aug;22(4):501-10
A comparative study of human GS2, its paralogues, and its rat orthologue.
Gao JG, Simon M
Biochemical and biophysical research communications 2007 Aug 24;360(2):501-6
Biochemical and biophysical research communications 2007 Aug 24;360(2):501-6
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Image(s): Western Blotting