H00023205-B01

ACSBG1 antibody from Abnova Corporation
BG1, BGM, FLJ30320, hBG1, hsBG, KIAA0631, MGC14352

Antibody data

Product number
H00023205-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00023205-B01, RRID:AB_1137700
Product name
ACSBG1 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00023205-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human ACSBG1 protein.
Antigen sequence
MPRNSGAGYGCPHGDPSMLDSRETPQESRQDMIVR
TTQEKLKTSSLTDRQPLSKESLNHALELSVPEKVN
NAQWDAPEEALWTTRADGRVRLRIDPSCPQLPYTV
HRMFYEALDKYGDLIALGFKRQDKWEHISYSQYYL
LARRAAKGFLKLGLKQAHSVAILGFNSPEWFFSAV
GTVFAGGIVTGIYTTSSPEACQYIAYDCCANVIMV
DTQKQLEKILKIWKQLPHLKAVVIYKEPPPNKMAN
VYTMEEFMELGNEVPEEALDAIIDTQQPNQCCVLV
YTSGTTGNPKGVMLSQDNITWTARYGSQAGDIRPA
EVQQEVVVSYLPLSHIAAQIYDLWTGIQWGAQVCF
AEPDALKGSLVNTLREVEPTSHMGVPRVWEKIMER
IQEVAAQSGFIRRKMLLWAMSVTLEQNLTCPGSDL
KPFTTRLADYLVLAKVRQALGFAKCQKNFYGAAPM
MAETQHFFLGLNIRLYAGYGLSETSGPHFMSSPYN
YRLYSSGKLVPGCRVKLVNQDAEGIGEICLWGRTI
FMGYLNMEDKTCEAIDEEGWLHTGDAGRLDADGFL
YITGRLKELIITAGGENVPPVPIEEAVKMELPIIS
NAMLIGDQRKFLSMLLTLKCTLDPDTSDQTDNLTE
QAMEFCQRVGSRATTVSEIIEKKDEAVYQAIEEGI
RRVNMNAAARPYHIQKWAILERDFSISGGELGPTM
KLKRLTVLEKYKGIIDSFYQEQKM
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -