HPA016594

ENPP4 antibody from Sigma-Aldrich
KIAA0879, NPP4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016594
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016594, RRID:AB_1848171
Product name
Anti-ENPP4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016594
Antibody type
Polyclonal
Antigen
Ectonucleotide pyrophosphatase/phosphodiesterase family member 4 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DEGWTIVLNESSQKLGDHGYDNSLPSMHPFLAAHG
PAFHKGYKHSTINIVDIYPMMCHILGLKPHPNNGT
FGHTKCLLVDQW
Storage
-20C
Provider Type Product Number
- No reagents -