HPA016594

ENPP4 antibody from Atlas Antibodies
AP3Aase, KIAA0879, NPP4
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA016594
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA016594, RRID:AB_1848171
Product name
Anti-ENPP4
Provider product page
Atlas Antibodies - HPA016594
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
DEGWTIVLNESSQKLGDHGYDNSLPSMHPFLAAHG
PAFHKGYKHSTINIVDIYPMMCHILGLKPHPNNGT
FGHTKCLLVDQW
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -