HPA010689

PTGER3 antibody from Sigma-Aldrich
EP3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010689
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010689, RRID:AB_1855883
Product name
Anti-PTGER3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010689
Antibody type
Polyclonal
Antigen
Prostaglandin E2 receptor EP3 subtype recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MKETRGYGGDAPFCTRLNHSYTGMWAPERSAEARG
NLTRPPGSGEDCGSVS
Storage
-20C
Provider Type Product Number
- No reagents -