Antibody data

Product number
H00023564-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00023564-M01, RRID:AB_1136921
Product name
DDAH2 monoclonal antibody (M01), clone 3E3
Provider product page
Abnova Corporation - H00023564-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant DDAH2.
Antigen sequence
MGTPGEGLGRCSHALIRGVPESLASGEGAGAGLPA
LDLAKAQREHGVLGGKLRQRLGLRLLELPPEESLP
LGPLLGDTAVIQGDTALITRPWSPARRPEVDGVRK
ALQDLGLRIVEIGDENATLDGTDVLFTGREFFVGL
SKWTNHRGAEIVADTFRDFAVSTVPVSGPSHLRGL
CGMGGPRTVVAGSSDAAQKAVRAMAVLTDHPYASL
TLPDDAAADCLFLRPGLPGVPPFLLHRGGGDLPNS
QEALQKLSDVTLVPVSCSELEKAGAGLSSLCLVLS
TRPHS
Isotype
IgG
Antibody clone number
3E3
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -