H00005521-M23

PPP2R2B antibody from Abnova Corporation
B55beta, PR52B, PR55-BETA, SCA12

Antibody data

Product number
H00005521-M23
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00005521-M23, RRID:AB_1579031
Product name
PPP2R2B monoclonal antibody (M23), clone 1B10
Provider product page
Abnova Corporation - H00005521-M23
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant PPP2R2B.
Antigen sequence
MEEDIDTRKINNSFLRDHSYATEADIISTVEFNHT
GELLATGDKGGRVVIFQREQESKNQVHRRGEYNVY
STFQSHEPEFDYLKSLEIEEKINKIRWLPQQNAAY
FLLSTNDKTVKLWKVSERDKRPEGYNLKDEEGRLR
DPATITTLRVPVLRPMDLMVEATPRRVFANAHTYH
INSISVNSDYETYMSADDLRINLWNFEITNQSFNI
VDIKPANMEELTEVITAAEFHPHHCNTFVYSSSKG
TIRLCDMRASALCDRHTKFFEEPEDPSNRSFFSEI
ISSISDVKFSHSGRYIMTRDYLTVKVWDLNMENRP
IETYQVHDYLRSKLCSLYENDCIFDKFECVWNGSD
SVIMTGSYNNFFRMFDRNTKRDVTLEASRENSKPR
AILKPRKVCVGGKRRKDEISVDSLDFSKKILHTAW
HPSENIIAVAATNNLYIFQDKVN
Isotype
IgG
Antibody clone number
1B10
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -