Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00004258-M01A - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00004258-M01A, RRID:AB_733215
- Product name
- MGST2 monoclonal antibody (M01A), clone 1D11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant MGST2.
- Antigen sequence
MAGNSILLAAVSILSACQQSYFALQVGKARLKYKV
TPPAVTGSPEFERVFRAQQNCVEFYPIFIITLWMA
GWYFNQVFATCLGLVYIYGRHLYFWGYSEAAKKRI
TGFRLSLGILALLTLLGALGIANSFLDEYLDLNIA
KKLRRQF- Isotype
- IgG
- Antibody clone number
- 1D11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Sodium nitroprusside decreased leukotriene C4 generation by inhibiting leukotriene C4 synthase expression and activity in hepatic ischemia-reperfusion injured rats.
Increased leukotriene c4 synthesis accompanied enhanced leukotriene c4 synthase expression and activities of ischemia-reperfusion-injured liver in rats.
Yang SL, Lou YJ
Biochemical pharmacology 2007 Mar 1;73(5):724-35
Biochemical pharmacology 2007 Mar 1;73(5):724-35
Increased leukotriene c4 synthesis accompanied enhanced leukotriene c4 synthase expression and activities of ischemia-reperfusion-injured liver in rats.
Yang SL, Huang X, Chen HF, Xu D, Chen LJ, Kong Y, Lou YJ
The Journal of surgical research 2007 Jun 1;140(1):36-44
The Journal of surgical research 2007 Jun 1;140(1):36-44
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of MGST2 transfected lysate using anti-MGST2 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with MGST2 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol