Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405444 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Uridine Phosphorylase 1 (UPP1) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-UPP1 antibody: synthetic peptide directed towards the N terminal of human UPP1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
AATGANAEKAESHNDCPVRLLNPNIAKMKEDILYH
FNLTT SRHNFPALFG- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references The role of thymidine phosphorylase and uridine phosphorylase in (fluoro)pyrimidine metabolism in peripheral blood mononuclear cells.
Temmink OH, de Bruin M, Laan AC, Turksma AW, Cricca S, Masterson AJ, Noordhuis P, Peters GJ
The international journal of biochemistry & cell biology 2006;38(10):1759-65
The international journal of biochemistry & cell biology 2006;38(10):1759-65
No comments: Submit comment
No validations: Submit validation data